Descargar la Biografia de Steve Jobs Gratis en Español
Hoy dia 28 acaba de salir la biografia de Steve Jobs en Español por lo que ya podéis descargárosla de iBooks Store por un precio de 15€, pero aqui en iJailbreak.es os ayudaremos a obtenerla totalmente Gratis por si no puedes pagar este precio.
Hoy dia 28 acaba de salir la biografia de Steve Jobs en Español por lo que ya podéis descargárosla de iBooks Store por un precio de 15€, pero aqui en iJailbreak.es os ayudaremos a obtenerla totalmente Gratis por si no puedes pagar este precio.
Obtenterla Gratis:
Descargamos el Archivo: Enlace 1 | Enlace 2 | Enlace 3 (Hay varios enlaces, por si falla, es la biografía completa en Español y sin DRM)
Vamos a iTunes a Añadir el Archivo a la Biblioteca
Seleccionamos el archivo .epub
Ahora, le damos a Aceptar, sincronizamos y Listo!!
Os dejo la Reseña:
La biografía exclusiva de Steve Jobs, el fundador de Apple, escrita con su colaboración.
Tras más de cuarenta entrevistas con Steve Jobs y con un centenar de personas de su entorno, familiares, amigos, adversarios y colegas, esta es la biografía definitiva de uno de los iconos indiscutibles de nuestro tiempo, la crónica de la agitada vida y abrasiva personalidad del genio cuya creatividad, energía y perfeccionismo ha revolucionado seis industrias: informática, películas de animación, música, teléfonos, tabletas y edición digital. Cuando el mundo busca cómo construir las bases de una economía digital, Jobs es un símbolo de la inventiva y de la imaginación práctica. Consciente de que la mejor manera de crear valor en el siglo XXI era conectar la creatividad con la tecnología, fundó una empresa en la que impresionantes saltos de la imaginación iban de la mano con asombrosos logros tecnológicos.
Aunque Jobs colaboró con el libro, no pidió ningún control sobre el contenido, ni siquiera el derecho a leerlo antes de la publicación. No rehuyó ningún tema y animó a la gente que conocía a hablar con franqueza.
“He hecho muchas cosas de las que no me siento orgulloso, como dejar a mi novia embarazada a los 23 años y cómo me comporté entonces, pero no hay ningún cadáver en mi armario que no pueda salir a la luz”.
Jobs habla con sinceridad, a veces brutal, sobre la gente con la que ha trabajado y contra la que ha competido. De igual modo, sus amigos, rivales y colegas ofrecen una vision sin edulcorar de las pasiones, los demonios, el perfeccionismo, los deseos, el talento, los trucos y la obsesión por controlarlo todo que modelan su visión empresarial y los innovadores productos que logró crear. Jobs podia desesperar a quienes le rodeaban. Pero su personalidad y sus productos han estado siempre interrelacionados, igual que el hardware y el software de Apple forman un potente sistema integrado. Su historia, por tanto, está llena de lecciones sobre innovación, carácter, liderazgo y valores. La historia de un genio capaz de enfurecer y seducir a partes iguales.



The very root of your writing while sounding reasonable
ResponderEliminaroriginally, did not really work perfectly with me after
some time. Somewhere within the paragraphs you managed to make me a believer but just for a while.
I nevertheless have got a problem with your leaps in logic and
you might do nicely to fill in all those gaps.
When you can accomplish that, I would definitely end
up
being amazed.
Here is my website; 3 10 to yuma quotes green eyes
my web site - pixnet.net
Nice post. I was checking constantly this blog and I am impressed!
ResponderEliminarExtremely
useful info specifically the last part :) I care for
such info a lot. I was looking for this particular info
for a very
long time. Thank you and good luck.
Feel free to visit my web page yorku.ca
Hmm is anyone else encountering problems with the pictures on this blog loading?
ResponderEliminarI'm trying
to determine if its a problem on my end or if it's the blog.
Any
suggestions would be greatly appreciated.
Here is my web blog : http://81.la/shogiwiki/index.php?title=Top_Five_Handi_projects_To_Buy_On_holiday_In_order_to_The_country:_Spanish_Workmanship_Is_actually_Top_quality_And_also_Beautiful
Hello! This post could not be written any better!
ResponderEliminarReading through this post reminds me of my good old room mate!
He always kept chatting
about this. I will forward this write-up to him. Pretty sure he
will have a good read.
Thank you for sharing!
My web-site http://shehbaazmind.blogspot.fr/
Definitely believe that which you said. Your favorite reason appeared
ResponderEliminarto be on the web the simplest thing to be aware of.
I say to you, I definitely get irked while people consider worries
that they just do not know
about. You managed to hit the nail upon the top and also defined out the whole thing without having side
effect , people can take a signal. Will likely be back
to get more. Thanks
Here is my web site :: blogspot.com
Good post however I was
ResponderEliminarwanting to know if you could write a litte more on this subject?
I'd be very grateful if you
could elaborate a little bit more. Kudos!
My web site :: spain presidential elections 2012
Pretty section of content. I just stumbled upon your site and in accession
ResponderEliminarcapital to assert that I get actually enjoyed account your blog
posts. Anyway I will
be subscribing to your feeds and even I achievement you access consistently rapidly.
Also visit my blog - spain x belgium fanfic
Hi there, just became aware of your blog through Google, and found that it's really
ResponderEliminarinformative. I am gonna watch out for brussels. I will appreciate if you continue
this in future. Many people will be benefited from your writing. Cheers!
Feel free to visit my weblog ; http://midisyuntiva.blogspot.ru
I like the valuable information you provide in your articles.
ResponderEliminarI will bookmark your blog
and check again here frequently. I am quite certain
I’ll learn
plenty of new stuff right here! Good luck for the next!
Also visit my web site ... grownursery.blogspot.ru
There are some fascinating points in time in this article but
ResponderEliminarI don’t know if I see all of them center to heart. There may
be some validity but I'll take hold opinion until I look into it
further. Good article , thanks and we wish extra! Added to FeedBurner as effectively
Feel free to surf my site ; streetlightblog.blogspot.fr
Hey there! Would you mind if I share your blog with my
ResponderEliminartwitter group? There's a lot of folks that I think would really enjoy your content.
Please let me know. Thanks
Feel free to surf my webpage ... 2012 calendar october through december
I'm curious to find out what blog system you have been working with? I'm experiencing some small security issues with
ResponderEliminarmy latest
blog and I'd like to find something more safeguarded. Do you have any solutions?
Feel free to visit my web blog : dreamsclub.altervista.org
I'm not sure why but this site is loading very slow for
ResponderEliminarme. Is anyone else having this issue or is it a problem on my end? I'll check back later on and
see if the problem still exists.
Feel free to visit my site - go38.net
Thank you for another informative blog. Where else could I get
ResponderEliminarthat kind of
information written in such an ideal way? I have a project that
I'm just now working on,
and I have been on the look out for such information.
Review my weblog ; http://prod-cybercommunes.Integra.fr
I loved up to you'll receive carried out right here. The sketch is attractive, your authored material
ResponderEliminarstylish. nonetheless, you command get got an impatience
over that you want be turning in the following.
unwell
indubitably come more beforehand again
as precisely the same just about a lot
steadily inside case you protect this increase.
Also visit my webpage - about spain culture
Hmm is anyone else encountering problems with the pictures on
ResponderEliminarthis blog loading? I'm trying
to figure out if its a problem on my end or if it's the blog.
Any feed-back would be greatly appreciated.
My blog post :: wooden houses for sale in spain
Howdy! Do you know if they make any plugins to help with
ResponderEliminarSEO? I'm trying to get my blog to rank for some targeted keywords but I'm not seeing very good
results. If you know of any please share. Thank you!
Here is my web site shayne-debretos-blog.blogg.asia
We're a bunch of volunteers and opening a new scheme in our community.
ResponderEliminarYour web site provided us with valuable information to paintings
on. You have done a formidable task and our entire
neighborhood can be grateful to
you.
Here is my webpage ; why are spain and portugal divided
Someone essentially help to make seriously posts I might state.
ResponderEliminarThat is the first time I
frequented your web page and thus far? I amazed with the
research you made to create this particular post incredible.
Wonderful activity!
Feel free to surf my weblog :: hyperion.andrew.cmu.edu
Pretty great post. I just stumbled upon your blog and wished to
ResponderEliminarmention
that I've truly loved surfing around your blog posts. In any case I will be subscribing in your rss feed and I'm hoping
you write again very soon!
My site - http://www.mvizru89.com/forum/profile.php?mode=viewprofile&u=127074&sid=fd4ddbed2548157c7be12b957aaa675e
I like the helpful information you provide on your
ResponderEliminararticles. I will bookmark your weblog and take a look at again right here
regularly. I am rather certain
I will be informed lots of new stuff proper here!
Best of luck for the following!
My web site - http://bobingabout.gamemod.net/
I like the helpful information you provide on your
ResponderEliminararticles. I will bookmark your weblog and take a look at
again right here
regularly. I am rather certain
I will be informed lots of new stuff proper here!
Best of luck for the following!
my page - http://bobingabout.gamemod.net/
A formidable share, I just given this onto a colleague who was
ResponderEliminardoing a bit evaluation on this. And he the truth is purchased me
breakfast as a result of I discovered it for him.
. smile. So let me reword that: Thnx for the deal with! However yeah
Thnkx for
spending the time to debate this, I feel strongly about it and love
reading more on this topic. If doable, as you develop into expertise, would you mind updating your blog with extra
details? It is extremely useful for me. Massive thumb up for this
blog post!
My website http://bstfoundation.co.uk/
you're truly a excellent webmaster. The website loading velocity is amazing. It seems that you
ResponderEliminarare doing any distinctive trick. Moreover, The contents are
masterwork. you have done a fantastic job on this matter!
Also see my web site - http://enzyme.engr.ccny.cuny.edu
I don’t even understand how I stopped up here,
ResponderEliminarhowever I assumed this put up used to be good. I
do not understand who you are however definitely you're going to a well-known blogger in case
you are not already ;) Cheers!
Here is my website http://vociglobali.it
Wonderful goods from you, man. I've understand your stuff previous to and
ResponderEliminaryou're just extremely wonderful. I really like what
you've acquired here, really like what you are stating and the way in which you
say it. You make it enjoyable and you still take care of to keep it sensible. I
can't wait to read much more from you. This is really a wonderful web site.
Also visit my web blog HTTP://Wiki.Juenger.com
Hey! I just wish to give a huge thumbs up for the great information you have got here on this post.
ResponderEliminarI shall be coming back to your weblog for extra soon.
Also visit my site http://www.essentialweb.asia/
I have been absent for a while, but now I remember why I used
ResponderEliminarto love this website.
Thanks , I’ll try and check back more frequently.
How frequently you update your site?
My web site http://jackketch.com/groups/hotels-inside-alicante-and-torrevieja
Superb blog you have here but I was curious if you
ResponderEliminarknew of any user discussion forums that cover the same topics discussed
here? I'd really like to
be a part of group where I can get opinions from other experienced people that share the same interest. If you have any
recommendations, please let me know. Kudos!
Here is my site ... http://wildebeest.com
It’s really a great and helpful piece of information. I’m glad that you
ResponderEliminarshared this
useful information with us. Please keep us up to date like this.
Thank you for
sharing.
Stop by my site ; Www.Diysolarheatingspain.com
I have been absent for some time, but now I remember why I used to love this blog.
ResponderEliminarThank you, I will try and check back more frequently.
How frequently you update your website?
Also see my page: http://wiki.ubuntu-party.org/
Pretty section of content. I just stumbled upon your website and
ResponderEliminarin accession
capital to assert that I get in fact enjoyed account your blog posts.
Anyway I will
be subscribing to your augment and even I achievement you access consistently rapidly.
Also visit my web-site - http://mse-codecomplete.dei.uc.pt/
Hello, you used to write magnificent, but
ResponderEliminarthe last several posts have
been kinda boring… I miss your tremendous writings.
Past several posts are just a little bit out of track! come on!
Also visit my blog post : cgk.czestochowa.pl
Have you ever considered creating an ebook or guest authoring on other
ResponderEliminarsites? I have a blog based on the same ideas you
discuss and would really like to have you share some
stories/information. I know my audience would enjoy your work.
If you are even remotely interested, feel free to
shoot me an e mail.
my website > capacityedu.info
I am typically to blogging and i actually respect your content.
ResponderEliminarThe article has actually peaks my interest. I am going to bookmark your
web site and maintain checking for brand new information.
Also visit my homepage ... http://www.club-sanjose.com
We're a group of volunteers and opening a new scheme in our community. Your site
ResponderEliminarprovided us with valuable information to work on. You've done
a formidable job
and our whole community will be thankful to you.
My page :: brasilcomz.com
Hey this is somewhat of off topic but I was
ResponderEliminarwanting to know if blogs use WYSIWYG editors or if you have
to manually code with HTML. I'm starting a blog soon but have
no coding skills so I wanted to get guidance from someone with
experience. Any help would be greatly appreciated!
Stop by my site : cgi35.plala.or.jp
Simply wish to say your article is as amazing. The
ResponderEliminarclarity to your post is simply great and i could suppose you're a professional on this subject. Fine along with your permission
let me to grasp your RSS feed to stay updated
with approaching post. Thanks 1,000,000 and please carry on the rewarding work.
Here is my blog - zakladki.no1.mielno.pl
magnificent issues altogether, you just won a
ResponderEliminaremblem new reader. What might you suggest in
regards to your
put up that you simply made a few days in the past? Any certain?
Here is my blog post blogspot.fr
Good - I should definitely pronounce, impressed with your website.
ResponderEliminarI had no trouble
navigating through all the tabs and related information ended up being truly simple to do
to access. I recently found what I hoped for before you know it
in the least. Quite unusual. Is
likely to appreciate it for those who add forums or something, web site theme .
a tones way for
your client to communicate. Excellent task..
Feel free to surf my site animesocietyuk.com
Hey there this is kinda of off topic but I was
ResponderEliminarwanting to know if blogs use WYSIWYG editors or if you have to manually code with HTML.
I'm starting a blog soon but have
no coding expertise so I wanted to get guidance from someone with
experience. Any help would be enormously appreciated!
my web site :: http://www.lipoblue.es/News/why-holiday-in-spain-wikipedia-nvlt-org/
What i do not realize is actually how you're not really much more well-liked than
ResponderEliminaryou may be right now. You're so intelligent.
You realize therefore
significantly relating to this subject, made me personally
consider it from so many varied angles. Its like women
and men aren't fascinated unless it’s one thing to
accomplish with Lady gaga! Your own stuffs excellent. Always maintain it up!
My web page - Realmbeyondsight.Blogspot.ru
You could definitely see your expertise in the work you write.
ResponderEliminarThe world hopes for
even more passionate writers like you who aren't afraid to say how they believe. Always follow
your heart.
My web site http://Sourly.Chary.Nkat.Forum.Mythem.es/
Hello there! I know this is kinda off topic
ResponderEliminarbut I was wondering if you knew where I could locate a captcha plugin for my comment form?
I'm using the same
blog platform as yours and I'm having difficulty finding one?
Thanks a lot!
My web site :: www.h-vene.fi
Would you be eager about exchanging links?
ResponderEliminarMy web page > Www.Authenticlinks.com
WONDERFUL Post.thanks for share..extra wait .. …
ResponderEliminarAlso visit my web page ; socialcircle.stock-options-picks.com
You can definitely see your expertise within the work
ResponderEliminaryou
write. The world hopes for even more passionate writers like you who aren't afraid to mention how they believe. At all times follow your heart.
Stop by my web page - http://baynaa.Blogspot.fr/2006/10/security-through-obscurity-i-login.html
I have been examinating out a few of your articles
ResponderEliminarand i can claim pretty good stuff. I will
definitely bookmark your blog.
Feel free to visit my blog : http://elgg.orenda.com.my
You made some nice points there. I looked on the internet for
ResponderEliminarthe issue and found most people will consent with
your site.
Also visit my web-site HTTP://shopping.Tntmarketingsolutions.ca/
What’s Happening i'm new to this, I stumbled upon this I have found It absolutely helpful and it has helped me out loads. I hope to contribute & assist other users like its helped me. Great job.
ResponderEliminarAlso see my web page :: authenticlinks.com
I've been absent for some time, but now I remember why I used to love this web site.
ResponderEliminarThank you, I’ll try and check back more frequently. How frequently you update your website?
Feel free to surf my homepage :: shiur.com
Heya i am for the primary time here. I came across
ResponderEliminarthis board and I in finding It
really helpful & it helped me out much. I am hoping to present something again and aid others
like you aided me.
Feel free to visit my webpage ... http://authenticlinks.com/
Hiya, I am really glad I've found this information. Nowadays bloggers publish just
ResponderEliminarabout gossips and web and this is really irritating. A good web site with exciting content, that's what I need.
Thank you for
keeping this website, I will be visiting it.
Do you do newsletters? Can't
find it.
my page - http://Chouettebeauty.blogspot.de
I delight in, result
ResponderEliminarin I found exactly what I used to be having a look for.
You have ended my four day lengthy hunt! God Bless you man.
Have a great day. Bye
my web page: dusit.ac.th
Most of what you say happens to be supprisingly
ResponderEliminarprecise and that makes me ponder the reason why I hadn't
looked at this with this light before. This piece truly did
switch the light on for me personally as far as this issue goes. But at this time there is one
particular issue I am not too comfy with
and while I attempt to reconcile that with the central
idea of the position, let me see just what all the
rest of your subscribers have to say.Very well done.
Feel free to surf my web page : http://bloggerspherepedia.blogspot.de
As a Newbie, I am permanently browsing online for articles
ResponderEliminarthat can
aid me. Thank you
My web blog : ncpoly.org
Throughout this great scheme of things you
ResponderEliminarsecure an A for effort. Where you actually confused us was in your details.
You know, it is said, the devil is in the details.
.. And it couldn't be
more accurate at this point. Having said that, allow me reveal to you exactly what
did give good results. Your authoring
is definitely extremely
persuasive which is probably why
I am making the effort in order to comment. I do not make it a regular habit of
doing that. Second, whilst I can
certainly notice a leaps in reasoning you come up with, I am not
necessarily certain of just how you seem to
connect your details which in turn produce
the final result. For right now I will
yield to your position however wish in the near future
you actually link your dots better.
Here is my web site ; http://svetsila.ru/
Its like you read my mind! You appear to know a lot about this, like
ResponderEliminaryou wrote the book in it or
something. I think that you can do with some pics to drive the message home
a little bit, but
other than that, this is wonderful blog. A great read.
I'll certainly be back.
Look at my web blog ; http://m1.cust.educ.ubc.ca/CUSTmoodle/user/view.php?id=7819&course=1
I like what you guys are up also. Such intelligent work and reporting!
ResponderEliminarKeep up the
superb works guys I’ve incorporated you guys to my blogroll.
I think it'll improve the value
of my site :)
Here is my weblog - livingwaychristianfriendshipgroup.com
Valuable info. Lucky me I found your website by accident, and I
ResponderEliminaram shocked why this
accident did not happened earlier! I bookmarked it.
Here is my website : http://futebol24.net/story.php?title=determining-how-to-get-a-costa-blanca-villa-eric-bruyndonckx
Hello.This post was extremely motivating, especially
ResponderEliminarbecause I was investigating for thoughts on this issue last
week.
Feel free to visit my homepage ... http://www.ezinearticles.gr/
Hi! I know this is kinda off topic
ResponderEliminarbut I was wondering which blog platform are you using for this site?
I'm getting sick and tired of
Wordpress because I've had problems with hackers and I'm looking at options for another platform. I
would be awesome if you could point me in the direction of a good platform.
My website ; org.ua
Does your website have a contact page? I'm having trouble locating it but, I'd like to
ResponderEliminarshoot you an e-mail. I've got some suggestions for your blog you
might be interested in hearing. Either way, great website and I look forward to seeing it improve over time.
Check out my web page ; http://theindependentcollective.net/members/susanking74/activity/200807
A lot of the
ResponderEliminarthings you mention happens to be supprisingly
accurate and that makes me wonder the reason why I had not
looked at this with this light before. Your article truly did
turn the light on for me as far as this
subject matter goes. Nevertheless at this time there
is actually one
particular position I am not really too cozy with
so whilst I attempt to reconcile that with the actual
main
idea of your issue, permit me observe what all the
rest of your visitors have to say.Well done.
Here is my homepage : http://biznaas.com/members/cindiehunter70/activity/214699
Whats up this is somewhat of off topic but I was
ResponderEliminarwanting to know if blogs use WYSIWYG editors or if you have to manually code with HTML.
I'm starting a blog soon but have
no coding knowledge so I wanted to get guidance from someone with
experience. Any help would be enormously appreciated!
My webpage :: gloriouslinks.com
Hello, you used to write excellent, but the last few posts have
ResponderEliminarbeen kinda boring… I miss your tremendous writings.
Past few posts are just a bit out of track! come on!
Feel free to surf to my website :: stratford.com.mx
Write more, thats all I have to say. Literally, it seems as though you relied on the video
ResponderEliminarto make your point. You
definitely know what youre talking about, why throw
away your intelligence on just posting
videos to your site when you could be giving us something
informative to read?
Look into my site - http://onlinefeednewsinfo.info/
My wife and i have been
ResponderEliminarso fortunate when
Louis managed to deal with
his basic research from your precious recommendations he received out
of your site. It's not at all simplistic to simply choose to be giving
freely points that many the rest have been trying to sell. And we fully understand we need you to thank for this. The entire illustrations
you've made, the easy site
navigation, the friendships you will help
to instill - it is all great, and it is facilitating our son and us
feel that this
matter is amusing, and that's
quite serious. Thanks for all the pieces!
Feel free to surf to my homepage; http://edinoborstva.bosa.org.ua/
I found your blog site on google and examine a couple
ResponderEliminarof of your early posts. Proceed to keep up the very good operate.
I simply extra up your RSS feed to my MSN News Reader.
Seeking ahead to studying extra from you
afterward!…
Feel free to surf to my blog www.adfty.net
We're a group of volunteers and starting a new scheme in our community. Your web site
ResponderEliminaroffered us with valuable information to work on. You have done an impressive job
and our entire community will be thankful to you.
Have a look at my weblog: http://wsemir.net
It’s actually a great and helpful piece of
ResponderEliminarinfo. I am glad that you shared this helpful
info with us. Please keep us up to date like this.
Thank you for sharing.
Stop by my webpage http://grabbabuddy.com/blog/view/3183/spain-on-a-shoestring
Hello There. I found your blog using msn. This is a very well written article.
ResponderEliminarI will
make sure to bookmark it and come back to read more of your useful info.
Thanks for the
post. I’ll definitely comeback.
Also visit my website :: http://www.desmotivacionais.com.br/elgg-1.8.8/blog/view/21810/golfing-in-spain
I just couldn't depart your site before suggesting that I really enjoyed the standard info a person provide for your visitors? Is gonna be back often to check up on new posts
ResponderEliminarMy web page http://Dalewebsite.com/profile/BasiliaReed1986
It's the best time to make a few plans for the longer term
ResponderEliminarand it is time to be happy. I have learn this post and if I
could I desire to recommend you few fascinating things or suggestions. Maybe you can write subsequent articles
referring to this article. I desire to learn more things approximately it!
Look into my web site; HTTP://Greatcornerstoneschools.com
The Oxycontin win boyfriend back medications or treatment for Oxycontin
ResponderEliminaraddiction are specially designed to make sure that
your body is like riding a bicycle: once you master it, you ask?
Fall is the time to do 7 day juice fasts, the money to spend on clove
capsules, dandelion root extract is found to be very harmful and which make you
feel fitter.
Here is my website :: homepage
If you're looking for a stop snoring solution,the best way to get the perfect mouthpiece that can fit into your mouth perfectly is to go to your dentist in order for you to get a custom fit stop snoring mouthpiece that can suit you best. If you suspect that you have sleep apnea, you should consult a medical specialist before using any stop snoring dental mouthpiece. Although eating a lot and then going to sleep seems like a very enjoyable pursuit, it can cause lots of physiological problems.
ResponderEliminar